missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200341

Invitrogen™ Human SIGLEC8 (aa 385-499) Control Fragment Recombinant Protein

Product Code. 30200341
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200341

Brand: Invitrogen™ RP90052

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110774 (PA5-110774. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIGLEC8 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3-linked sialic acid. and also binds to alpha2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLEC8 is expressed specifically on eosinophils. The protein contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in downmodulation of cellular responses. The phosphorylated ITIM motif binds to the SH2 domain of PTPN6/SHP-1. The SIGLEC8 gene belongs to the immunoglobulin superfamily.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYZ4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27181
Name Human SIGLEC8 (aa 385-499) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CDw329; MGC59785; SAF2; SAF-2; sialic acid binding Ig like lectin 8; sialic acid binding Ig-like lectin 8; sialic acid-binding Ig-like lectin 8; Sialoadhesin family member 2; Siglec; SIGLEC8; Siglec-8; SIGLEC8L
Common Name SIGLEC8
Gene Symbol SIGLEC8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.