Invitrogen™ Human SHOX (aa 50-105) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30201389	100 μL	100µL

Product Code. 30201389 Supplier Invitrogen™ Supplier No. RP107034

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66351 (PA5-66351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Homeodomain proteins (HP) are transcriptional regulators that coordinate the expression of genes involved in development, differentiation and cellular transformation. HPs are characterized by a conserved domain of 60 amino acid residues that recognize and bind a site in the regulatory region of the target gene. SHOX, a member of the bicoid subfamily of the paired homeobox family, controls fundamental aspects of growth and development and undergoes splicing resulting in two isoforms, SHOXA and SHOXB. SHOXA is expressed in skeletal muscle, placental, pancreas, heart and bone marrow fibroblast and, to a lesser extent, in kidney and lung. SHOXB is highly expressed in osteogenic cells, but not expressed in brain, kidney, liver or lung. Defects in the gene SHOXX cause Leri-Weill dyschondrosteosis (LWD) and Langer mesomelic dysplasia (LMD).

Specifications

• Accession Number: O15266
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6473
• Name: Human SHOX (aa 50-105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GCFX; growth control factor, X-linked; PHOG; Pseudoautosomal homeobox-containing osteogenic protein; short stature homeobox; short stature homeobox protein; Short stature homeobox-containing protein; SHOX; SHOXY; SS
• Common Name: SHOX
• Gene Symbol: SHOX
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining