missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202248

Invitrogen™ Human SHMT2 (aa 410-496) Control Fragment Recombinant Protein

Product Code. 30202248
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202248

Brand: Invitrogen™ RP91763

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54232 (PA5-54232. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian serine hydroxymethyltransferase (SHMT) is a tetrameric, pyridoxal phosphate (PLP)-dependent enzyme that catalyzes the reversible interconversion of serine and tetrahydrofolate to glycine and methylenetetrahydrofolate in the cytoplasm (cSHMT, SHMT1) and mitochondria (mSHMT, SHMT2). cSHMT preferentially supplies one-carbon units for thymidylate biosynthesis, depletes methylenetetrahydrofolate pools for S-adenosylmethionine (SAM) synthesis by synthesizing serine, sequesters 5-methyltetrahydrofolate, and inhibits SAM synthesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P34897
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6472
Name Human SHMT2 (aa 410-496) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700043D08Rik; AA408223; AA986903; epididymis secretory sperm binding protein Li 51 e; GLY A+; GLYA; glycine auxotroph A, human complement for hamster; glycine hydroxymethyltransferase; HEL-S-51 e; mitochondrial serine hydroxymethyltransferase; serine aldolase; serine hydroxymethylase; serine hydroxymethyltransferase; serine hydroxymethyltransferase 2; serine hydroxymethyltransferase 2 (mitochondrial); serine hydroxymethyltransferase, mitochondrial; Serine methylase; SHMT; SHMT 2; SHMT2; threonine aldolase
Common Name SHMT2
Gene Symbol SHMT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.