Invitrogen™ Human SHMT1 (aa 1-69) Control Fragment Recombinant Protein

Product Code. 30198091

Brand: Invitrogen™ RP93454

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54758 (PA5-54758. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Specifications

• Accession Number: P34896
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6470
• Name: Human SHMT1 (aa 1-69) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI324848; AI385541; C81125; CSHMT; cytoplasmic serine hydroxymethyltransferase; cytosolic form; cytosolic serine hydroxymethyltransferase; glycine hydroxymethyltransferase; LRRGT00032; MEL-32; MGC15229; MGC24556; mshmt; mshmt1; mshmt2; serine hydroxymethyl transferase; serine hydroxymethyltransferase; serine hydroxymethyltransferase 1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase 1 (soluble) isoform 1; serine hydroxymethyltransferase 2 (mitochondrial); serine hydroxymethyltransferase, cytosolic; Serine methylase; SHMT; Shmt1; shmt1 protein; SHMT2; zgc:66171; zgc:77524; zSHMT-1
• Common Name: SHMT1
• Gene Symbol: Shmt1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining