Invitrogen™ Human SHB (aa 340-400) Control Fragment Recombinant Protein

Product Code. 30211365

Brand: Invitrogen™ RP106373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65701 (PA5-65701. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SH2 (Src Homology 2) domain is a structurally conserved motif that contains two alpha helices and seven beta strands and is found in a variety of proteins that are involved in signal transduction throughout the cell. Specifically, the SH2 domain targets SH2 domain-containing proteins to tyrosinephosphorylated sites, an event that can trigger a protein-protein interaction cascade which may ultimately effect gene expression and cellular function. Shb (SH2 domain-containing adapter protein b), Shd (SH2 domain-containing adapter protein d), She (SH2 domain-containing adapter protein e) and Shf(SH2 domain-containing adapter protein f) are SH2 domain-containing proteins that play various roles throughout the cell.

Specifications

• Accession Number: Q15464
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6461
• Name: Human SHB (aa 340-400) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA3J10.2; BC028832; SH2 domain containing adaptor protein B; SH2 domain-containing adapter protein B; Shb; SHB (Src homology 2 domain containing) adaptor protein B; SHB adaptor protein (a Src homology 2 protein); Src homology 2 domain containing adaptor protein B; src homology 2 domain-containing transforming protein B
• Common Name: SHB
• Gene Symbol: SHB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining