Invitrogen™ Human SH3YL1 (aa 1-69) Control Fragment Recombinant Protein

Product Code. 30212807

Brand: Invitrogen™ RP95960

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56594 (PA5-56594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q96HL8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26751
• Name: Human SH3YL1 (aa 1-69) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: RAY; SH3 and SYLF domain containing 1; SH3 domain containing, Ysc84-like 1; SH3 domain-containing YSC84-like protein 1; SH3YL1
• Common Name: SH3YL1
• Gene Symbol: SH3YL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining