Invitrogen™ Human SH3TC2 (aa 315-396) Control Fragment Recombinant Protein

Product Code. 30197228

Brand: Invitrogen™ RP102781

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58058 (PA5-58058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein with two N-terminal Src homology 3 (SH3) domains and 10 tetratricopeptide repeat (TPR) motifs, and is a member of a small gene family. The gene product has been proposed to be an adapter or docking molecule. Mutations in this gene result in autosomal recessive Charcot-Marie-Tooth disease type 4C, a childhood-onset neurodegenerative disease characterized by demyelination of motor and sensory neurons.

Specifications

• Accession Number: Q8TF17
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79628
• Name: Human SH3TC2 (aa 315-396) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CMT4C; D430044G18Rik; KIAA1985; MNMN; PP12494; RGD1309038; SH3 domain and tetratricopeptide repeat-containing protein 2; SH3 domain and tetratricopeptide repeats 2; SH3 domain and tetratricopeptide repeats-containing protein 2; SH3TC2
• Common Name: SH3TC2
• Gene Symbol: SH3TC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining