Invitrogen™ Human SH3TC1 (aa 33-107) Control Fragment Recombinant Protein

Product Code. 30210227

Brand: Invitrogen™ RP94983

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58258 (PA5-58258. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SH3TC1 is a protein coding gene.

Specifications

• Accession Number: Q8TE82
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54436
• Name: Human SH3TC1 (aa 33-107) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: SH3 domain and tetratricopeptide repeat-containing protein 1; SH3 domain and tetratricopeptide repeats 1; SH3 domain and tetratricopeptide repeats-containing protein 1; SH3TC1
• Common Name: SH3TC1
• Gene Symbol: SH3TC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTVVMRPSVSWEKAGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining