Invitrogen™ Human SH3GLB2 (aa 165-246) Control Fragment Recombinant Protein

Product Code. 30212939

Brand: Invitrogen™ RP93012

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54407 (PA5-54407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SH3GLB2 (SH3 Domain Containing GRB2 Like, Endophilin B2) is a Protein Coding gene. Among its related pathways are Endocytosis. An important paralog of this gene is SH3GLB1. [GeneCards]

Specifications

• Accession Number: Q9NR46
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56904
• Name: Human SH3GLB2 (aa 165-246) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EMBL:AAH87652.1}; endophilin-B2; Kiaa1848; PP578; PP6569; PP9455; retinoid receptor-induced gene 1; RRIG1; SH3 domain containing GRB2 like endophilin B2; SH3 domain-containing GRB2-like protein B2; SH3-containing protein SH3GLB2; SH3-domain GRB2-like endophilin B2; Sh3glb2; sh3glb2 {ECO:0000312; SPAS-1; stimulator of prostatic adenocarcinoma-specific T-cells-1
• Common Name: SH3GLB2
• Gene Symbol: SH3GLB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining