Invitrogen™ Human SH3GL3 (aa 194-288) Control Fragment Recombinant Protein

Artikelnummer. 30182696

Marke: Invitrogen™ RP98097

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58766 (PA5-58766. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SH3GL3 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Spezifikation

• Accession Number: Q99963
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6457
• Name: Human SH3GL3 (aa 194-288) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CNSA3; EEN-B2; Endophilin 3; endophilin A3; endophilin III; endophilin-3; Endophilin-A3; HsT19371; SH3 domain containing GRB2 like 3; SH3 domain containing GRB2 like 3, endophilin A3; SH3 domain containing GRB2 like endophilin A3; SH3 domain protein 2 C1; SH3 domain protein 2 C2; SH3 domain protein 2 C; SH3 domain-containing GRB2-like protein 3; Sh3d2c; Sh3d2c1; Sh3d2c2; SH3-domain GRB2-like 3; Sh3gl3; SH3p13
• Common Name: SH3GL3
• Gene Symbol: Sh3gl3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining