missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211353

Invitrogen™ Human SH3GL2 (aa 217-310) Control Fragment Recombinant Protein

Product Code. 30211353
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211353

Brand: Invitrogen™ RP92910

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55377 (PA5-55377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Enables identical protein binding activity. Involved in negative regulation of blood-brain barrier permeability; negative regulation of gene expression; and negative regulation of protein phosphorylation. Located in perinuclear region of cytoplasm.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99962
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6456
Name Human SH3GL2 (aa 217-310) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530001L19Rik; AI120490; AW555077; B930049H17Rik; bA335L15.1; bA335L15.1 (SH3-domain GRB2-like 2); CNSA2; Een1; EEN-B1; endophilin; endophilin A1; Endophilin A1 BAR domain; endophilin I; endophilin-1; Endophilin-A1; FLJ20276; FLJ25015; SH3 domain containing GRB2 like 2; SH3 domain containing GRB2 like 2, endophilin A1; SH3 domain protein 2 A; SH3 domain-containing GRB2-like protein 2; Sh3d2a; SH3-domain GRB2-like 2; SH3GL2; Sh3p4; SH3PA
Common Name SH3GL2
Gene Symbol Sh3gl2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.