Invitrogen™ Human SH3BGRL3 (aa 22-93) Control Fragment Recombinant Protein

Product Code. 30198279

Brand: Invitrogen™ RP94257

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56575 (PA5-56575. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SH3BGRL3 could act as a modulator of glutaredoxin biological activity.

Specifications

• Accession Number: Q9H299
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83442
• Name: Human SH3BGRL3 (aa 22-93) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110004L05Rik; AU022188; epididymis secretory protein Li 297; HEL-S-297; P1725; SH3 domain binding glutamate rich protein like 3; SH3 domain binding glutamate-rich protein like 3; SH3 domain binding glutamic acid-rich protein like 3; SH3 domain binding glutamic acid-rich protein-like 3; SH3 domain-binding glutamic acid-rich-like protein 3; SH3 domain-binding protein 1; SH3BGRL3; SH3BGRL3-like protein; SH3BP-1; TIP-B1; TNF inhibitory protein
• Common Name: SH3BGRL3
• Gene Symbol: SH3BGRL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining