Invitrogen™ Human SH2D4A (aa 27-150) Control Fragment Recombinant Protein

Product Code. 30210520

Brand: Invitrogen™ RP101006

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51648 (PA5-51648. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SH2D4A inhibits estrogen-induced cell proliferation by competing with PLCG for binding to ESR1, blocking the effect of estrogen on PLCG and repressing estrogen-induced proliferation. SH2D4A may play a role in T-cell development and function.

Specifications

• Accession Number: Q9H788
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63898
• Name: Human SH2D4A (aa 27-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210402M20Rik; FLJ20967; PPP1R38; protein phosphatase 1 regulatory subunit 38; protein phosphatase 1, regulatory subunit 38; protein SH(2)A; SH2 domain containing 4 A; SH2 domain-containing 4 A; SH2 domain-containing protein 4 A; SH2A; SH2D4A
• Common Name: SH2D4A
• Gene Symbol: SH2D4A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFFKMREEQIRRWKEREAAMERKESLPVKPRPKKENGKSVHWKLGADKEVWVWVMGEHHLDKPYDVLCNEIIAERARLKAEQEAEEPRKTHSEEFTNSLKTKSQYHDLQAPDNQQTKDIWKKVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining