Invitrogen™ Human SH2D3C (aa 311-404) Control Fragment Recombinant Protein

Product Code. 30196874

Brand: Invitrogen™ RP92892

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83872 (PA5-83872. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 is required to induce membrane ruffling and promote EGF-dependent cell migration.

Specifications

• Accession Number: Q8N5H7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10044
• Name: Human SH2D3C (aa 311-404) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cas/HEF1-associated signal transducer; CHAT; Novel SH2-containing protein 3; NSP3; PRO34088; SH2 domain containing 3 C; SH2 domain-containing Eph receptor-binding protein 1; SH2 domain-containing protein 3 C; Sh2d3c; Shep1; UNQ272/PRO309/PRO34088
• Common Name: SH2D3C
• Gene Symbol: SH2D3C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining