Invitrogen™ Human SGLT1 (aa 572-642) Control Fragment Recombinant Protein

Product Code. 30200641

Brand: Invitrogen™ RP100900

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84085 (PA5-84085. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucose transporters are integral membrane proteins that mediate the transport of glucose and structurally-related substances across cellular membranes. Two families of glucose transporter have been identified: the facilitated-diffusion glucose transporter family. The SLC5A1 gene encodes a protein that is involved in the active transport of glucose and galactose into eukaryotic and some prokaryotic cells.

Specifications

• Accession Number: P13866
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6523
• Name: Human SGLT1 (aa 572-642) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D22S675; High affinity sodium-glucose cotransporter; HSGLT1; MGC93553; Na; Na(+)/glucose cotransporter 1; Na+/glucose cotransporter 1; NAGT; Sglt1; SLC5A1; sodium glucose cotransporter 1; sodium/glucose cotransporter 1; sodium-glucose cotransporter 1; sodium-glucose cotransporter-like 1; solute carrier family 5 (sodium/glucose cotransporter), member 1; solute carrier family 5 member 1; solute carrier family 5, member 1; solute carrier family 5, member alpha 1; Solute carrier family 5, member alpha 1 (Na+/glucose cotransporter)
• Common Name: SGLT1
• Gene Symbol: Slc5a1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining