missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SGK3 (aa 365-487) Control Fragment Recombinant Protein

Product Code. 30205025
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205025

Brand: Invitrogen™ RP88958

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SGKL (SGK3) is a serine/threonine protein kinase which is similar to serum- and glucocorticoid-induced protein kinase (SGK). Unlike SGK, SGKL is not induced by serum or glucocorticoids. It is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96BR1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23678
Name Human SGK3 (aa 365-487) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510015P22Rik; A330005P07Rik; CISK; cytokine-independent survival kinase; DKFZp781N0293; fy; fz; Serine/threonine-protein kinase Sgk3; serum glucocorticoid regulated kinase 3; serum/glucocorticoid regulated kinase 3; serum/glucocorticoid regulated kinase family member 3; serum/glucocorticoid regulated kinase family, member 3; serum/glucocorticoid-regulated kinase 3; Serum/glucocorticoid-regulated kinase-like; SGK2; SGK3; Sgkl
Common Name SGK3
Gene Symbol SGK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.