Invitrogen™ Human SGK223 (aa 601-704) Control Fragment Recombinant Protein

Product Code. 30202771

Brand: Invitrogen™ RP89816

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52905 (PA5-52905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRAGMIN is also known as SGK223 (sugen kinase 223). The rat homolog was originally identified in a yeast two-hybrid screen for Rnd2 effector proteins expressed in neural cells. Rat Pragmin was found to stimulate RhoA activity for the regulation of neurite outgrowth.

Specifications

• Accession Number: Q86YV5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 157285
• Name: Human SGK223 (aa 601-704) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830148H23; D8Ertd82e; DNA segment, Chr 8, ERATO Doi 82, expressed; homolog of rat pragma of Rnd2; Inactive tyrosine-protein kinase PRAG1; mFLJ00269; NACK; Notch activation complex kinase; PEAK1-related kinase-activating pseudokinase 1; Prag1; Pragma of Rnd2; pragmin; RGD1311793; Sgk223; Sugen kinase 223; tyrosine-protein kinase SgK223
• Common Name: SGK223
• Gene Symbol: PRAG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNGVAISDPSRCPQPAASSASEQRRPRFQAGTWSRQCRIEEEEEVEQELLSHSWGRETKNGPTDHSNSTTWHRLHPTDGSSGQNSKVGTGMSKSASFAFEFPKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining