Invitrogen™ Human SGIP1 (aa 246-347) Control Fragment Recombinant Protein

Product Code. 30211759

Brand: Invitrogen™ RP90737

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53681 (PA5-53681. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SGIP1 functions as an endocytic protein that affects signaling by receptors in neuronal systems involved in energy homeostasis via its interaction with endophilins.

Specifications

• Accession Number: Q9BQI5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84251
• Name: Human SGIP1 (aa 246-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110007P09Rik; endophilin-3-interacting protein; gag; I79_011488; SGIP1; SGIP1alpha; SH3 domain GRB2 like endophilin interacting protein 1; SH3-containing GRB2-like protein 3-interacting protein 1; SH3-domain GRB2-like (endophilin) interacting protein 1; SH3-domain GRB2-like interacting protein 1 alpha
• Common Name: SGIP1
• Gene Symbol: SGIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTPPPLPPKNVPATPPRTGSPLTIGPGNDQSATEVKIEKLPSINDLDSIFGPVLSPKSVAVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPATPDNPADSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining