Invitrogen™ Human SGF29 (aa 116-188) Control Fragment Recombinant Protein

Product Code. 30181386

Brand: Invitrogen™ RP98592

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62816 (PA5-62816. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC101 is a subunit of 2 histone acetyltransferase complexes: the ADA2A -containing -TAF9 /PCAF acetylase (STAGA) complex. Both of these complexes contain either GCN5 or PCAF, which are paralogous acetyltransferases.

Specifications

• Accession Number: Q96ES7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112869
• Name: Human SGF29 (aa 116-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CCDC101; coiled-coil domain containing 101; coiled-coil domain-containing protein 101; SAGA complex associated factor 29; SAGA complex-associated factor 29; SAGA-associated factor 29; SAGA-associated factor 29 homolog; SGF29; STAF36; TDRD29
• Common Name: SGF29
• Gene Symbol: SGF29
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining