Invitrogen™ Human SFXN3 (aa 290-321) Control Fragment Recombinant Protein

Product Code. 30202318

Brand: Invitrogen™ RP104847

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65497 (PA5-65497. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (PubMed:30442778). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Also catalyzes an electroneutral exchange of tricarboxylate, dicarboxylate, or phosphoenolpyruvate across the mitochondrial inner membrane.

Specifications

• Accession Number: Q9BWM7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81855
• Name: Human SFXN3 (aa 290-321) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BA108L7.2; SFX3; SFXN3; sideroflexin 3; sideroflexin-3; TCC; tricarboxylate carrier; tricarboxylate carrier-like protein
• Common Name: SFXN3
• Gene Symbol: SFXN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSIHISNLEPELRAQIHEQNPSVEVVYYNKGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining