Invitrogen™ Human SFRS19 (aa 828-923) Control Fragment Recombinant Protein

Product Code. 30182492

Brand: Invitrogen™ RP99013

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61345 (PA5-61345. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Splicing factor that seems to antagonize SR proteins in pre-mRNA splicing regulation. Also binds the repetitive C-terminal domain (CTD) of RNA polymerase II; may act with other CTD binding proteins to link transcription and pre-mRNA processing.

Specifications

• Accession Number: Q9H7N4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58506
• Name: Human SFRS19 (aa 828-923) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI480556; CTD-binding SR-like protein rA1; CTD-binding SR-like rA1; SCAF; Scaf1; Serine arginine-rich pre-mRNA splicing factor SR-A1; SFRS19; Splicing factor, arginine/serine-rich 19; SRA1; Sr-a1; SR-related and CTD-associated factor 1; SR-related CTD associated factor 1; SR-related CTD-associated factor 1; SR-related C-terminal domain-associated factor 1; SR-related-CTD-associated factor
• Common Name: SFRS19
• Gene Symbol: SCAF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining