Invitrogen™ Human SFRS18 (aa 13-151) Control Fragment Recombinant Protein

Product Code. 30209241

Brand: Invitrogen™ RP90224

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58544 (PA5-58544. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SFRS18 is a protein coding gene.

Specifications

• Accession Number: Q8TF01
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25957
• Name: Human SFRS18 (aa 13-151) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730406M06Rik; AA673174; argi; arginine/serine-rich protein PNISR; bA98I9.2; C6orf111; HSPC261; HSPC306; Pinsr; PNISR; PNN interacting serine and arginine rich protein; PNN interacting serine/arginine-rich; PNN-interacting serine/arginine-rich protein; RGD1307395; RP11-98I9.2; serine/arginine-rich splicing factor 18; serine/arginine-rich-splicing regulatory protein 130; serine-arginine-rich-splicing regulatory protein 130; Sfrs18; splicing factor, arginine/serine-rich 130; Splicing factor, arginine/serine-rich 18; SR rich protein; SR-related protein; SR-rich protein; SRrp130; Srsf18
• Common Name: SFRS18
• Gene Symbol: PNISR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQREASGQQSMVEQPPGMMPNGQDMSTMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPPPDQPWMPPTPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining