missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SFRS15 (aa 353-444) Control Fragment Recombinant Protein

Product Code. 30211846
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211846

Brand: Invitrogen™ RP91820

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53780 (PA5-53780. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The family of SR factors all contain one or more RNA recognition motifs (RRM) and an SR-rich domain. They are not only essential for constitutive splicing, but also regulate splicing in a concentration-dependent manner by influencing the selection of alternative splice sites. Splicing factor arginine/serine-rich 15 (SFRS15), also designated CTD-binding SR-like protein RA4, contains one RRM and one SR-rich domains. SFRS15 interacts with C-terminal repetitive domain (CTD) of Pol II and is believed to functionally and physically link transcription and pre-mRNA processing. Localized to the nucleus, SFRS15 is expressed as two isoforms produced by alternative splicing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95104
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57466
Name Human SFRS15 (aa 353-444) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA517739; CTD-binding SR-like protein RA4; KIAA1172; pre-mRNA splicing SR protein rA4; SCAF4; serine/arginine-rich splicing factor 15; SFR15; SFRS15; splicing factor serine alanine 15; splicing factor, arginine/serine-rich 15; SRA4; SR-like CTD-associated factor 4; SR-related and CTD-associated factor 4; SR-related CTD associated factor 4; SR-related CTD-associated factor 4; Srsf15
Common Name SFRS15
Gene Symbol SCAF4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPCIQEVKRHMSDNRKSRSRSASRSPK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.