Invitrogen™ Human SFRP4 (aa 33-172) Control Fragment Recombinant Protein

Product Code. 30211971

Brand: Invitrogen™ RP88742

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52679 (PA5-52679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Secreted Frizzled-Related Proteins (sFRPs) are a family of glycosylated Wnt antagonists characterized by a conserved cysteine-rich domain that shares homology with the cysteine-rich, extracellular domain Frizzled proteins use for the binding of Wnt proteins and receptors. Lacking the transmembrane and intracellular domains of the Frizzled proteins, sFRPs function as soluble modulators of the Wnt signaling pathway through the direct binding of Wnt proteins to this cysteine-rich domain, and the resultant inhibition of Wnt receptor binding and signaling capabilities. sFRP-4 is widely distributed in a variety of embryonic and adult tissues where it can function as a circulating antiangiogenic factor, a potent proapoptotic factor, an inhibitor of insulin secretion, and a suppressor of both tumor growth and metastatic potential through disruption of the Wnt signaling pathway. Research has demonstrated the existence of a direct correlation between the downregulation and/or absence of circulating sFRP-4 and the progression of several cancer types, including ovarian, endometrial, prostate and lung. Upregulation of circulating sFRP-4 has been linked to the deterioration of glucose metabolism in the case of type 2 diabetes, as well as the suppression of the keratinocyte hyperproliferation and epidermal hyperlasia that are definitive of psoriasis.

Specifications

• Accession Number: Q6FHJ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6424
• Name: Human SFRP4 (aa 33-172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ddc4; DDC-4 protein; Frizzled protein, human endometrium; frizzled related protein; frizzled-related protein; frizzled-related protein 4; FRP; FRP-4; FRPHE; MGC26498; secreted frizzled related protein 4; secreted frizzled-related protein 4; secreted frizzled-related protein 4; secreted frizzled-related protein 4; secreted frizzled-related sequence protein 4; Sfrp4; sFRP-4
• Common Name: SFRP4
• Gene Symbol: SFRP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining