Invitrogen™ Human SFPQ (aa 575-640) Control Fragment Recombinant Protein

Product Code. 30208031

Brand: Invitrogen™ RP104138

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84215 (PA5-84215. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SFPQ, also named PSF, encodes a nuclear factor implicated in the splicing and regulation of gene expression. SFPQ probably forms a heteromer with NONO and participates in DNA pairing and DNA break repair program. Very recently SFPQ was identified as a downstream target of tau, complete nuclear depletion and cytoplasmic accumulation of SFPQ were shown in the neurons and astrocytes of brains with Alzheimer's disease (AD), more strikingly, reduced SFPQ levels may progress together with tau pathology, these observation strongly suggests the important role of SFPQ pathology in neurodegenerative diseases including AD. SFPQ protein may appears as 47 kDa, 52 kDa or 100 kDa molecules in various cell types.

Specifications

• Accession Number: P23246
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6421
• Name: Human SFPQ (aa 575-640) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 100 kDa DNA-pairing protein; 1110004P21Rik; 2810416M14Rik; 5730453G22Rik; 9030402K04Rik; AU021830; D4Ertd314e; DNA-binding p52/p100 complex, 100 kDa subunit; Gm12940; hPOMp100; NonO/p54nrb homolog; OTTMUSG00000009329; polypyrimidine tract binding protein associated; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; POMP100; PPP1R140; protein phosphatase 1, regulatory subunit 140; PSF; PTB-associated splicing factor; PTB-associated-splicing factor; REP1; Sfpq; splicing factor proline and glutamine rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); splicing factor proline/glutamine-rich; splicing factor, proline- and glutamine-rich
• Common Name: SFPQ
• Gene Symbol: SFPQ
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining