Invitrogen™ Human SF3B3 (aa 331-410) Control Fragment Recombinant Protein

Product Code. 30180532

Brand: Invitrogen™ RP98584

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60187 (PA5-60187. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex transcription coactivator-HAT complex, and the TFTC -containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Specifications

• Accession Number: Q15393
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23450
• Name: Human SF3B3 (aa 331-410) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810061H24Rik; 5730409A01Rik; AA409318; D8Ertd633e; Kiaa0017; mKIAA0017; pre-mRNA splicing factor SF3b, 130 kDa subunit; pre-mRNA-splicing factor SF3b 130 kDa subunit; RSE1; SAP 130; SAP130; SF3b130; SF3B3; Spliceosome-associated protein 130; splicing factor 3 b subunit 3; splicing factor 3 b, subunit 3; STAF130
• Common Name: SF3B3
• Gene Symbol: SF3B3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining