missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SF3B3 (aa 331-410) Control Fragment Recombinant Protein

Product Code. 30180532
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180532

Brand: Invitrogen™ RP98584

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60187 (PA5-60187. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex transcription coactivator-HAT complex, and the TFTC -containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q15393
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23450
Name Human SF3B3 (aa 331-410) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810061H24Rik; 5730409A01Rik; AA409318; D8Ertd633e; Kiaa0017; mKIAA0017; pre-mRNA splicing factor SF3b, 130 kDa subunit; pre-mRNA-splicing factor SF3b 130 kDa subunit; RSE1; SAP 130; SAP130; SF3b130; SF3B3; Spliceosome-associated protein 130; splicing factor 3 b subunit 3; splicing factor 3 b, subunit 3; STAF130
Common Name SF3B3
Gene Symbol SF3B3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.