missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195420

Invitrogen™ Human SF3B14 (aa 64-124) Control Fragment Recombinant Protein

Product Code. 30195420
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195420

Brand: Invitrogen™ RP96001

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57077 (PA5-57077. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SF3B14 encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y3B4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51639
Name Human SF3B14 (aa 64-124) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610009D07Rik; 6030419K15Rik; AV001342; CGI-110; HSPC175; Ht006; P14; pre mRNA branch site protein p14; pre-mRNA branch site protein p14; SAP14; SAP14a; SF3b 14 kDa subunit; Sf3b14; SF3B14a; SF3B6; spliceosome-associated protein, 14 kDa subunit; spliceosome-associated protein, 14-kDa; Splicing factor 3 B subunit 6; splicing factor 3 B, 14 kDa subunit; splicing factor 3 B, 14 kDa subunit-like; splicing factor 3 B, subunit 6; splicing factor 3 b, subunit 6, 14 kDa
Common Name SF3B14
Gene Symbol SF3B6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.