Invitrogen™ Human SF3A1 (aa 44-218) Control Fragment Recombinant Protein

Product Code. 30210919

Brand: Invitrogen™ RP91383

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56334 (PA5-56334. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q15459
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10291
• Name: Human SF3A1 (aa 44-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200014H24Rik; 5930416L09Rik; AI159724; pre-mRNA processing 21; pre-mRNA splicing factor SF3a (120 kDa subunit); PRP21; PRPF21; SAP 114; SAP114; Sf3a1; sf3a1 protein; SF3A120; si:dz150f13.2; spliceosome-associated protein 114; splicing factor 3 subunit 1; splicing factor 3 A subunit 1; splicing factor 3 A, subunit 1; splicing factor 3 A, subunit 1, 120 kD; splicing factor 3 A, subunit 1, 120 kDa; Unknown (protein for MGC:65786); wu:fc38e01; wu:fc50a11; wu:fj37c05; zgc:65786
• Common Name: SF3A1
• Gene Symbol: Sf3a1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining