missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211627

Invitrogen™ Human SETMAR (aa 257-339) Control Fragment Recombinant Protein

Product Code. 30211627
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211627

Brand: Invitrogen™ RP105089

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SETMAR (SET domain and mariner transposase fusion gene) is a histone methyltransferase that methylates Lys-4 and Lys-36 of histone H3, creating specific tags for epigenetic transcriptional activation. It specifically mediates dimethylation of H3 Lys-36. SETMAR has sequence-specific DNA-binding activity, and recognizes the 19-mer core of the 5'-terminal inverted repeats (TIRs) of the Hsmar1 transposable element. SETMAT has DNA nicking activity, and in vivo end-joining activity, and may mediate genomic integration of foreign DNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q53H47
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6419
Name Human SETMAR (aa 257-339) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830404F24Rik; epidermal tumor expressed transcript 2; Etet2; Histone-lysine N-methyltransferase; Histone-lysine N-methyltransferase SETMAR; Mar1; METNASE; SET domain and mariner transposase fusion gene; SET domain and mariner transposase fusion gene-containing protein; SET domain and mariner transposase fusion gene-containing protein homolog; SET domain and mariner transposase fusion protein; SET domain and mariner transposase fusion protein homolog; SET domain without mariner transposase fusion; SET domain without mariner transposase fusion protein; Setmar; Transposon Hsmar1 transposase
Common Name SETMAR
Gene Symbol SETMAR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.