Invitrogen™ Human SETD8 (aa 158-255) Control Fragment Recombinant Protein

Product Code. 30201800

Brand: Invitrogen™ RP107338

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111583 (PA5-111583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SETD8 is a histone methyltransferase that specifically monomethylates 'Lys-20' of histone H4. H4 'Lys-20' monomethylation is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. The protein mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. It is required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNA during mitosis. It is also involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substrate compared to free histones.

Specifications

• Accession Number: Q9NQR1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 387893
• Name: Human SETD8 (aa 158-255) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410195B05Rik; AA617402; AW536475; H4-K20-HMTase; H4-K20-HMTase KMT5A; H4-K20-HMTase SETD8; H4-K20-specific histone methyltransferase; H4K20-specific histone methyltransferase splice variant Set8b; histone methyltransferase Pr-set7/Set8; histone-lysine N-methyltransferase KMT5A; histone-lysine N-methyltransferase SETD8; KMT5A; lysine (K)-specific methyltransferase 5 A; lysine methyltransferase 5 A; lysine N-methyltransferase 5 A; Lysine-specific methylase 5 A; N-lysine methyltransferase KMT5A; N-lysine methyltransferase SETD8; PR/SET domain containing protein 8; PR/SET domain-containing protein 07; PR/SET07; PRSET7; PR-Set7; RGD1305893; SET domain containing (lysine methyltransferase) 8; SET domain containing protein 8 variant 1; SET domain containing protein 8 variant 2; SET domain-containing 8; SET domain-containing protein 8; SET07; SET8; SETD8; Unknown (protein for MGC:134426)
• Common Name: SETD8
• Gene Symbol: KMT5A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining