Invitrogen™ Human SETD7 (aa 266-340) Control Fragment Recombinant Protein

Product Code. 30209526

Brand: Invitrogen™ RP96680

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation. [UniProt]

Specifications

• Accession Number: Q8WTS6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80854
• Name: Human SETD7 (aa 266-340) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600028F23Rik; FLJ21193; H3-K4 methyltransferase; H3-K4-HMTase; H3-K4-HMTase SETD7; H3K4MT; Histone H3-K4 methyltransferase SETD7; histone H3-lysine 4-specific methyltransferase; histone-lysine N-methyltransferase SETD7; Kiaa1717; KMT7; lysine N-methyltransferase 7; mKIAA1717; OTTHUMP00000220049; SET domain containing (lysine methyltransferase) 7; SET domain containing 7, histone lysine methyltransferase; SET domain containing 7, lysine methyltransferase; SET domain containing lysine methyltransferase 7; SET domain-containing protein 7; Set7; Set7/9; SET9; Setd7
• Common Name: SETD7
• Gene Symbol: Setd7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining