missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SETD6 (aa 167-239) Control Fragment Recombinant Protein

Product Code. 30181489
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181489

Brand: Invitrogen™ RP98545

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59588 (PA5-59588. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SETD6 (SET domain-containing protein 6) is a 473 amino acid protein that belongs to the SETD6 family. Containing one SET domain, SETD6 is structurally similar to the Rubisco large subunit methyltransferase. SETD6 is a proteinlysine N-methyltransferase that specifically monomethylates 'Lys-310' of the NFκB p65 subunit of NFκB complex, leading to down-regulate NFκB transcription factor activity. SETD6-mediated methylation renders NFκB p65 inert and attenuates NFκB p65-driven transcriptional programs, including inflammatory responses in primary immune cells. The SETD6-initiated lysine-methylation signaling cascade acts to restrain activation of NFκB-mediated inflammatory responses in diverse cell types.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TBK2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79918
Name Human SETD6 (aa 167-239) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610039J04Rik; 3110004G14Rik; AI413388; C76402; N-lysine methyltransferase SETD6; RGD1560538; SET domain containing 6; SET domain-containing protein 6; SETD6
Common Name SETD6
Gene Symbol SETD6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.