Invitrogen™ Human SETD2 (aa 2143-2242) Control Fragment Recombinant Protein

Product Code. 30212793

Brand: Invitrogen™ RP96462

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83615 (PA5-83615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone methyltransferase that specifically trimethylates 'Lys-36' of histone H3 (H3K36me3) using dimethylated 'Lys-36' (H3K36me2) as substrate. Represents the main enzyme generating H3K36me3, a specific tag for epigenetic transcriptional activation. Plays a role in chromatin structure modulation during elongation by coordinating recruitment of the FACT complex and by interacting with hyperphosphorylated POLR2A. Acts as a key regulator of DNA mismatch repair in G1 and early S phase by generating H3K36me3, a mark required to recruit MSH6 subunit of the MutS alpha complex: early recruitment of the MutS alpha complex to chromatin to be replicated allows a quick identification of mismatch DNA to initiate the mismatch repair reaction. H3K36me3 also plays an essential role in the maintenance of a heterochromatic state, by recruiting DNA methyltransferase DNMT3A. H3K36me3 is also enhanced in intron-containing genes, suggesting that SETD2 recruitment is enhanced by splicing and that splicing is coupled to recruitment of elongating RNA polymerase. Required during angiogenesis. Recruited to the promoters of adenovirus 12 E1A gene in case of infection, possibly leading to regulate its expression.

Specifications

• Accession Number: Q9BYW2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29072
• Name: Human SETD2 (aa 2143-2242) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921524K10Rik; BC031601; FLJ16420; FLJ22472; FLJ23184; FLJ45883; HBP231; HIF1; HIF-1; HIP-1; histone-lysine N-methyltransferase SETD2; hSET2; HSPC069; huntingtin interacting protein 1; huntingtin yeast partner B; Huntingtin-interacting protein 1; Huntingtin-interacting protein B; HYPB; Kiaa1732; Kif9; kinesin family member 9; KMT3A; LLS; lysine N-methyltransferase 3 A; p231HBP; Protein-lysine N-methyltransferase SETD2; SET domain containing 2; SET domain containing 2, histone lysine methyltransferase; SET domain-containing protein 2; SET2; Setd2
• Common Name: SETD2
• Gene Symbol: Setd2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining