Invitrogen™ Human SETD1A (aa 357-432) Control Fragment Recombinant Protein

Product Code. 30203228

Brand: Invitrogen™ RP104165

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63563 (PA5-63563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SET1A is a component of a histone methyltransferase (HMT) complex that produces mono-, di-, and trimethylated histone H3 at Lys4. The complex is the analog of the S. cerevisiae Set1/COMPASS complex.

Specifications

• Accession Number: O15047
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9739
• Name: Human SETD1A (aa 357-432) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC010250; Histone-lysine N-methyltransferase SETD1A; hSET1A; KIAA0339; KMT2F; Lysine N-methyltransferase 2 F; mKIAA0339; mNSC1; non-selective cation channel 1; Nsccn1; SET domain containing 1 A; SET domain-containing protein 1 A; SET1; Set1/Ash2 histone methyltransferase complex subunit SET1; SET1A; SETD1A
• Common Name: SETD1A
• Gene Symbol: SETD1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining