missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201727

Invitrogen™ Human SESTD1 (aa 74-149) Control Fragment Recombinant Protein

Product Code. 30201727
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201727

Brand: Invitrogen™ RP108680

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85032 (PA5-85032. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SESTD1 was initially identified in mutant zebrafish with defects in the spontaneous contraction and touch response as a novel gene, solo, encoding a protein containing SEC14 and spectrin repeat domains. Other experiments indicated that SESTD1 interacts with the TRPC4 and TRPC5, members of the transient receptor potential channel family, via the TRPC calmodulin- and inositol 1, 4, 5-triphosphate receptor-binding domain and is essential for efficient receptor-mediated activation of TRPC5, suggesting that SESTD1 is a novel regulator of these TRPC proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86VW0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91404
Name Human SESTD1 (aa 74-149) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500031J16Rik; A930010O20; EGK_04585; Huntingtin-interacting protein-like protein; protein Solo; RGD1562244; SEC14 and spectrin domain containing 1; SEC14 and spectrin domains 1; SEC14 domain and spectrin repeat-containing protein 1; Sestd1; SOLO; Solo/Trio8
Common Name SESTD1
Gene Symbol Sestd1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.