Invitrogen™ Human SERPINA10 (aa 285-435) Control Fragment Recombinant Protein

Product Code. 30194218

Brand: Invitrogen™ RP88933

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83924 (PA5-83924. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis. Alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: Q9UK55
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51156
• Name: Human SERPINA10 (aa 285-435) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: plasma protein associated with liver regeneration; protein Z-dependent protease inhibitor; PZ-dependent protease inhibitor; PZI; Rasp1; RASP-1; Regeneration-associated serpin 1; serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serpin A10; serpin family A member 10; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serpin peptidase inhibitor, clade A, member 10; Serpina10; UNQ707/PRO1358; Zpi
• Common Name: SERPINA10
• Gene Symbol: SERPINA10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining