Invitrogen™ Human SERC2 Control Fragment Recombinant Protein

Product Code. 30194406

Brand: Invitrogen™ RP102192

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52233 (PA5-52233. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SERINC2 (Serine Incorporator 2) is a Protein Coding gene. Diseases associated with SERINC2 include Rapp-Hodgkin Syndrome and Alcohol Dependence. Among its related pathways are Viral mRNA Translation and Metabolism. Gene Ontology (GO) annotations related to this gene include L-serine transmembrane transporter activity. An important paralog of this gene is SERINC1. [GeneCards]

Specifications

• Accession Number: Q96SA4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 347735
• Name: Human SERC2 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310004K20Rik; AW121759; FKSG84; PRO0899; Serinc2; Serine incorporator 2; TDE2; TDE2L; tumor differentially expressed protein 2; Tumor differentially expressed protein 2-like; UNQ263/PRO300
• Common Name: SERC2
• Gene Symbol: SERINC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSSDHRQVNSLMQTEECPPMLDATQQQQQQVAACEGRAFDNEQDGVT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining