Invitrogen™ Human Septin 3 (aa 196-334) Control Fragment Recombinant Protein

Product Code. 30197716

Brand: Invitrogen™ RP91497

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51959 (PA5-51959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9UH03
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55964
• Name: Human Septin 3 (aa 196-334) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110018K01Rik; 3-Sep; AV154067; B530002E20Rik; bK250D10.3; CTA-250D10.3; G-septin; G-septin alpha; MGC133218; neuronal-specific septin 3; neuronal-specific septin-3; OTTHUMP00000028742; P40; Sep3; SEPT3; septin 3; Septin3
• Common Name: Septin 3
• Gene Symbol: SEPT3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining