Invitrogen™ Human SEPHS2 (aa 71-117) Control Fragment Recombinant Protein

Product Code. 30209270

Brand: Invitrogen™ RP100770

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83888 (PA5-83888. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. This protein itself contains a selenocysteine residue in its predicted active site. The 3' UTR of the gene has a stem-loop secondary structure called a selenocysteine insertion sequence (SECIS) element, which allows UGA to direct the incorporation of selenocysteine rather than signal a translational stop.

Specifications

• Accession Number: Q99611
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22928
• Name: Human SEPHS2 (aa 71-117) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: clone 1000; selenide; selenide, water dikinase 2; Selenium donor protein 2; selenophosphate synthase 2; selenophosphate synthetase 2; Sephs2; Sps2; SPS2b; the SelD gene product; Ysg3
• Common Name: SEPHS2
• Gene Symbol: SEPHS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining