Invitrogen™ Human SENP8 (aa 142-211) Control Fragment Recombinant Protein

Product Code. 30193928

Brand: Invitrogen™ RP95846

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83318 (PA5-83318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SENP8 (Cysteine protease FKSG8; DEN1; FKSG8; HsT17512; NEDP1; PRSC2; SUMO/sentrin specific protease family member 8), is a novel cysteine protease which belongs to the ULP family of deubiquitinases. ULP family members consist of a C-terminal core catalytic domain and N-terminal extensions determining substrate specificity. SENP8, a 24KDa protein, plays a major role in regulating NEDD8 pathway. It processes preNEDD8 to its mature form and deconjugates NEDD8 from substrates such as Cullins and p53. SENP8 may play a role in preventing accumulation of hyper-neddylated cullin and maintaining the level of mono-neddylated cullin that is thought to increase the efficiency of ubiquitination by SCF ubiquitin ligases.

Specifications

• Accession Number: Q96LD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 123228
• Name: Human SENP8 (aa 142-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9130010J17Rik; AU020827; DEN1; deneddylase 1; deneddylase-1; FKSG8; NEDD8 specific-protease cysteine 2; NEDD8-specific protease 1; Nedp1; protease, cysteine 2; protease, cysteine, 2 (NEDD8 specific); PRSC2; SENP8; sentrin/SUMO-specific protease SENP8; Sentrin-specific protease 8; SUMO sentrin specific protease family member 8; SUMO/sentrin peptidase family member, NEDD8 specific; SUMO/sentrin specific peptidase 8; SUMO/sentrin specific peptidase family member 8; SUMO/sentrin specific protease 8; SUMO/sentrin specific protease family member 8; Sumo1/sentrin/SMT3 specific peptidase 8
• Common Name: SENP8
• Gene Symbol: Senp8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining