Invitrogen™ Human SENP7 (aa 224-320) Control Fragment Recombinant Protein

Product Code. 30210975

Brand: Invitrogen™ RP109272

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140139 (PA5-140139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SENP7 is a protease that may be involved in two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature conjugatable forms and/or deconjugation of SUMO1, SUMO2 and SUMO3 from targeted substrate proteins.

Specifications

• Accession Number: Q9BQF6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57337
• Name: Human SENP7 (aa 224-320) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410152H17Rik; 2810413I22Rik; 2900036C23Rik; 6030449K19Rik; AI790676; KIAA1707; SENP7; sentrin/SUMO-specific protease SENP7; Sentrin-specific protease 7; SSP2; SUMO1/sentrin specific peptidase 7; SUMO1/sentrin specific protease 7; Sumo1/sentrin/SMT3 specific peptidase 7; SUMO-1-specific protease 2; Susp2
• Common Name: SENP7
• Gene Symbol: SENP7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQESRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining