Invitrogen™ Human SEMA4F (aa 311-380) Control Fragment Recombinant Protein

Product Code. 30198061

Brand: Invitrogen™ RP108496

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84626 (PA5-84626. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.

Specifications

• Accession Number: O95754
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10505
• Name: Human SEMA4F (aa 311-380) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: M-SEMA; m-Sema-M; PRO2353; S4F; sema domain immunoglobulin domain transmembrane domain (TM) and short cytoplasmic domain (semaphorin) 4 F; sema domain, immunoglobulin domain (Ig), TM domain, and short cy; sema domain, immunoglobulin domain (Ig), TM domain, and short cytoplasmic domain; sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4 F; Sema M; Sema W; Sema4f; SEMAM; semaphorin 4 f; semaphorin M; semaphorin W; semaphorin-4 F; Semaphorin-M; semaphorin-W; SEMAW; ssemaphorin 4 F
• Common Name: SEMA4F
• Gene Symbol: SEMA4F
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining