Invitrogen™ Human Seipin (aa 58-135) Control Fragment Recombinant Protein

Product Code. 30198246

Brand: Invitrogen™ RP90433

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59966 (PA5-59966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes protein seipin, which is located in the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q96G97
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26580
• Name: Human Seipin (aa 58-135) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900097C17Rik; AI046355; Berardinelli-Seip congenital lipodystrophy 2 (seipin); Berardinelli-Seip congenital lipodystrophy 2 homolog (seipin); Bernardinelli-Seip congenital lipodystrophy 2 homolog; Bernardinelli-Seip congenital lipodystrophy type 2 protein; Bernardinelli-Seip congenital lipodystrophy type 2 protein homolog; bscl2; bscl2 {ECO:0000250; BSCL2, seipin lipid droplet biogenesis associated; G protein gamma 3 linked; Gng3lg; HMN5; MNCb-2630; PELD; seipin; SPG17; UniProtKB:Q96G97}
• Common Name: Seipin
• Gene Symbol: BSCL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining