missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SEC31A (aa 648-783) Control Fragment Recombinant Protein

Product Code. 30205917
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205917

Brand: Invitrogen™ RP89208

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52147 (PA5-52147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is similar to yeast Sec31 protein. Yeast Sec31 protein is known to be a component of the COPII protein complex which is responsible for vesicle budding from endoplasmic reticulum (ER). This protein was found to colocalize with SEC13, one of the other components of COPII, in the subcellular structures corresponding to the vesicle transport function. An immunodepletion experiment confirmed that this protein is required for ER-Golgi transport. Alternative splicing results in multiple transcript variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94979
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22872
Name Human SEC31A (aa 648-783) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810024J13Rik; ABP125; ABP130; AU042160; cb354; HSPC275; HSPC334; KIAA0905; LOW QUALITY PROTEIN: protein transport protein Sec31A; protein transport protein Sec31A; SEC31 homolog A (S. cerevisiae); SEC31 homolog A, COPII coat complex component; SEC31 homolog A, COPII coating complex component; sec31a; SEC31L1; SEC31-like 1; SEC31-like protein 1; sec31p; sec31p homolog; SEC31-related protein A; Unknown (protein for MGC:63547); VAP1; vesicle associated protein; vesicle-associated protein 1; Web1-like protein; yeast Sec31p homolog; zgc:63547
Common Name SEC31A
Gene Symbol SEC31A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.