Invitrogen™ Human SEC31A (aa 648-783) Control Fragment Recombinant Protein

Product Code. 30205917

Brand: Invitrogen™ RP89208

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52147 (PA5-52147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is similar to yeast Sec31 protein. Yeast Sec31 protein is known to be a component of the COPII protein complex which is responsible for vesicle budding from endoplasmic reticulum (ER). This protein was found to colocalize with SEC13, one of the other components of COPII, in the subcellular structures corresponding to the vesicle transport function. An immunodepletion experiment confirmed that this protein is required for ER-Golgi transport. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: O94979
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22872
• Name: Human SEC31A (aa 648-783) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810024J13Rik; ABP125; ABP130; AU042160; cb354; HSPC275; HSPC334; KIAA0905; LOW QUALITY PROTEIN: protein transport protein Sec31A; protein transport protein Sec31A; SEC31 homolog A (S. cerevisiae); SEC31 homolog A, COPII coat complex component; SEC31 homolog A, COPII coating complex component; sec31a; SEC31L1; SEC31-like 1; SEC31-like protein 1; sec31p; sec31p homolog; SEC31-related protein A; Unknown (protein for MGC:63547); VAP1; vesicle associated protein; vesicle-associated protein 1; Web1-like protein; yeast Sec31p homolog; zgc:63547
• Common Name: SEC31A
• Gene Symbol: SEC31A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining