Invitrogen™ Human SEC22C (aa 95-173) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30210363	100 μL	100µL

Product Code. 30210363 Supplier Invitrogen™ Supplier No. RP106646

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65957 (PA5-65957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in vesicle transport between the ER and the Golgi complex.

Specifications

• Accession Number: Q9BRL7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9117
• Name: Human SEC22C (aa 95-173) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932412K21; 5930407I15Rik; C530046H07; SEC22 homolog C, vesicle trafficking protein; SEC22 vesicle trafficking protein homolog C; SEC22 vesicle trafficking protein homolog C (S. cerevisiae); SEC22 vesicle trafficking protein-like 3; SEC22 vesicle trafficking protein-like C; SEC22 vesicle trafficking protein-like protein C; SEC22 vesicle-trafficking protein homolog C; SEC22 vesicle-trafficking protein-like 3; SEC22C; Sec22l3; secretion deficient 22 C; Unknown (protein for MGC:134135); UNQ459/PRO784; Vesicle-trafficking protein SEC22c
• Common Name: SEC22C
• Gene Symbol: SEC22C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining