Invitrogen™ Human SDR39U1 Control Fragment Recombinant Protein

Product Code. 30210999

Brand: Invitrogen™ RP109475

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140172 (PA5-140172. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative NADP-dependent oxidoreductase.

Specifications

• Accession Number: Q9NRG7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56948
• Name: Human SDR39U1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310014G06Rik; C14orf124; Epimerase family protein SDR39U1; HCDI; RGD1309307; SDR39U1; short chain dehydrogenase/reductase family 39 U member 1; short chain dehydrogenase/reductase family 39 U, member 1; short-chain dehydrogenase/reductase family 39 U member 1
• Common Name: SDR39U1
• Gene Symbol: Sdr39u1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNLAGENILNPLRRWNETFQKEVLGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining