Invitrogen™ Human SDHD (aa 22-66) Control Fragment Recombinant Protein

Product Code. 30200477

Brand: Invitrogen™ RP100470

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61081 (PA5-61081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial succinate dehydrogenase complex subunit D (SDHD) is one of four proteins that make up the tricarboxylic cycle enzyme succinate dehydrogenase (SCH). Studies have shown that mutations in SDHD often leads to hereditary paragangliomas, usually benign tumors of the autonomic nervous system, suggesting that SDHD also plays a role as a tumor-suppressor gene. In one family with a nonsense mutation (R22X) in the SDHD gene, a loss of heterozygosity was found in the paragangliomas, and within these tumors the enzymatic activity of Complex II in the mitochondrial respiratory chain was completely abolished. Furthermore, high levels of angiogenic factors EPAS1 and VEGF was observed, which may stimulate tumor growth.

Specifications

• Accession Number: O14521
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6392
• Name: Human SDHD (aa 22-66) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110001M13Rik; AVLL5809; C78570; CBT1; CII-4; CWS3; CybS; PGL; PGL1; PRO19626; QPs3; SDH4; SDHD; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; succinate dehydrogenase complex subunit D; succinate dehydrogenase complex subunit D integral membrane protein; succinate dehydrogenase complex, subunit D, integral membrane protein; succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
• Common Name: SDHD
• Gene Symbol: SDHD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining