Invitrogen™ Human SDHA (aa 421-492) Control Fragment Recombinant Protein

Product Code. 30209960

Brand: Invitrogen™ RP105321

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66693 (PA5-66693. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a major catalytic subunit of succinate-ubiquinone oxidoreductase, a complex of the mitochondrial respiratory chain. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. Mutations in this gene have been associated with a form of mitochondrial respiratory chain deficiency known as Leigh Syndrome. A pseudogene has been identified on chromosome 3q29.

Specifications

• Accession Number: P31040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6389
• Name: Human SDHA (aa 421-492) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500032O14Rik; 2310034D06Rik; 4921513A11; C81073; CMD1GG; Flavoprotein subunit of complex II; FP; im:7141001; mitochondrial succinate dehydrogenase complex subunit A; PGL5; SDH1; SDH2; SDHA; SDHA protein; SDHF; SDHFP1; si:dkeyp-84f11.2; succinate dehydrogenase [ubiquinone] flavoprotein subunit; succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial; succinate dehydrogenase complex flavoprotein subunit A; succinate dehydrogenase complex subunit A; succinate dehydrogenase complex subunit A flavoprotein; succinate dehydrogenase complex subunit A, flavoprotein (Fp); succinate dehydrogenase complex, subunit A, flavoprotein (Fp); succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase flavoprotein subunit A; zgc:56051
• Common Name: SDHA
• Gene Symbol: SDHA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining