Invitrogen™ Human SCYL3 (aa 81-228) Control Fragment Recombinant Protein

Product Code. 30212608

Brand: Invitrogen™ RP110021

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145025 (PA5-145025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in regulating cell adhesion/migration complexes in migrating cells.

Specifications

• Accession Number: Q8IZE3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57147
• Name: Human SCYL3 (aa 81-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200016D23Rik; 6030457O16; AW214499; ezrin-binding partner PACE-1; ezrin-binding partner PACE-1 (PACE-1); ezrin-binding protein PACE-1; Pace1; PACE-1; protein-associating with the carboxyl-terminal domain of ezrin; RP1-97P20.2; SCY1 like pseudokinase 3; SCY1-like 3; SCY1-like 3 (S. cerevisiae); SCY1-like protein 3; SCY1-like, kinase-like 3; Scyl3
• Common Name: SCYL3
• Gene Symbol: SCYL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTERVQPLEVALETLSSAEVCAGIYDILLALIFLHDRGHLTHNNVCLSSVFVSEDGHWKLGGMETVCKVSQATPEFLRSIQSIRDPASIPPEEMSPEFTTLPECHGHARDAFSFGTLVESLLTILNEQVSADVLSSFQQTLHSTLLNP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining