Invitrogen™ Human SCUBE3 (aa 476-566) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30212827	100 μL	100µL

Product Code. 30212827 Supplier Invitrogen™ Supplier No. RP94883

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59221 (PA5-59221. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCUBE3 is a member of a family of secreted glycoproteins that contain N-terminal EGF-like repeats and C-terminal cysteine-rich motifs and CUB domain and is highly expressed in primary osteoblasts and bones, and to a lesser extent in heart. Other studies have shown that overexpression of SCUBE3 in mice induced cardiac hypertrophy, suggesting that it may also play a role in the regulation of cardiac growth. SCUBE3 has been shown to be an endogenous TGF-Beta receptor ligand and is thought to promote lung cancer cell mobility and invasiveness. In lung cancer cells, the secreted SCUBE3 protein was cleaved by MMP2 and MMP9, allowing the activation of the TGF-Beta receptor, the increase of Smad2/3 transcriptional activity and the upregulation of expression of proteins such as TGF-Beta1, VEGF, Snail, and Slug.

Specifications

• Accession Number: Q8IX30
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 222663
• Name: Human SCUBE3 (aa 476-566) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CEGF3; CUB domain and EGF-like repeat containing 3; D030038I21Rik; SCUBE3; signal peptide; signal peptide, CUB and EGF-like domain containing protein 3; signal peptide, CUB and EGF-like domain-containing protein 3; signal peptide, CUB domain and EGF like domain containing 3; signal peptide, CUB domain, EGF-like 3
• Common Name: SCUBE3
• Gene Symbol: SCUBE3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLSIKQRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEETTAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining